HTTP/1.1 200 OK Cache-Control: private Date: Tue, 12 Dec 2017 12:55:29 GMT Server: Microsoft-IIS/7.0 Content-Length: 39621 Content-Type: text/html; charset=utf-8 Content-Type: text/html; charset=utf-8 Client-Date: Tue, 12 Dec 2017 12:56:59 GMT Client-Peer: 204.9.46.203:80 Client-Response-Num: 1 Link: ; /="/"; rel="stylesheet"; type="text/css" Link: ; /="/"; rel="stylesheet"; type="text/css" Link: ; /="/"; rel="stylesheet"; type="text/css" Link: ; /="/"; rel="stylesheet"; type="text/css" Link: ; /="/"; rel="stylesheet"; type="text/css" Link: ; /="/"; rel="stylesheet"; type="text/css" Set-Cookie: ASP.NET_SessionId=ak5gre550mxejr45jfnzcu45; path=/; HttpOnly Set-Cookie: BrowserGuid=b4aae8ca-394c-4e62-8bb3-8315fedacb5e; expires=Thu, 11-Jan-2018 12:55:29 GMT; path=/ Title: Anti-DHRS13 Antibody, - OriGene X-AspNet-Version: 2.0.50727 X-Meta-Description: DHRS13 - Rabbit Polyclonal Anti-DHRS13 Antibody available from OriGene X-Meta-Keywords: DHRS13, SDR7C5, antibody, lysate, cDNA ORF clones, protein X-Powered-By: ASP.NET Anti-DHRS13 Antibody, - OriGene
OriGene Logo
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Antibody All anti-DHRS13 antibodies

Anti-DHRS13 Antibody

div

Specifications Citations Customer Reviews Product Documents
SKU Description Amount Price Availability*  
TA335396 Rabbit Polyclonal Anti-DHRS13 Antibody 50ug $325 3-7 days
Add to Shopping Cart
spacer
WB(1)
spacer
Also for DHRS13 (NM_144683)
cDNA Clone shRNA/siRNA CRISPR KO Kit Protein Antibody

OriGene Data

ImmunogenThe immunogen for Anti-DHRS13 Antibody is: synthetic peptide directed towards the C-terminal region of Human DHRS13. Synthetic peptide located within the following region: DPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSKMTHRIQAKVEPE
Clone Name IsotypeIgG
Species ReactivityHuman, Dog, Rabbit, Horse, Bovine ConcentrationLot dependent; please refer to CoA along with shipment
Guaranteed Application *WB Suggested DilutionsWB
Predicted MW Explanation 38kDa
BufferShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Note Immunogen Sequence Homology: Human: 100%; Dog: 85%; Rabbit: 82%; Horse: 79%; Bovine: 79%

Reference Data

Target Namedehydrogenase/reductase 13
Alternative NameSDR7C5
Database LinkNP_653284
Entrez Gene 147015 Human
Entrez Gene 0 Mouse
Entrez Gene 0 Rat
Entrez Gene 0 Monkey
Entrez Gene 100856212 Dog
FunctionDHRS13 is a putative oxidoreductase.
Related PathwayDruggable Genome

* Availability is in business days
* OriGene provides validated application data and protocol, with money back guarantee.


WB Image
Host: Rabbit; Target Name: DHRS13; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml
grey_line

 

spacer
Inc 5000 Healthcare Company

Notice to Non-US Customers

ExclaimationWeb price and delivery time are for direct sales only.

Non-US customers are encouraged to contact our dedicated distributor network for quotes and streamlined ordering/delivery support.

Acknowledge